APOBEC2 Antibody
| Name | APOBEC2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57469 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat, Dog |
| Antigen | Synthetic peptides corresponding to APOBEC2 (apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2) The peptide sequence was selected from the N terminal of APOBEC2. Peptide sequence VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPAN |
| Purity/Format | IgG purified |
| Description | Rabbit Polyclonal |
| Gene | APOBEC2 |
| Supplier Page | Shop |
![Western Blot: APOBEC2 Antibody [NBP1-57469] - Titration: 1.25ug/ml, Positive Control: Human Muscle.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/7633_APOBEC2%2520Antibody-Western%2520Blot-NBP1-57469-img0001.jpg)
![Immunohistochemistry-Paraffin: APOBEC2 Antibody [NBP1-57469] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/7634_APOBEC2%2520Antibody-Immunohistochemistry-Paraffin-NBP1-57469-img0002.jpg)