| Name | SFRS9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57465 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SFRS9(splicing factor, arginine/serine-rich 9) The peptide sequence was selected from the middle region of SFRS9. Peptide sequence VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SRSF9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |