Name | CPEB2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57459 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to CPEB2 (cytoplasmic polyadenylation element binding protein 2) The peptide sequence was selected from the middle region of CPEB2. Peptide sequence SNTLLPLQVRSSLQLPAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMH. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | CPEB2 |
Supplier Page | Shop |