CPEB2 Antibody

Name CPEB2 Antibody
Supplier Novus Biologicals
Catalog NBP1-57459
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to CPEB2 (cytoplasmic polyadenylation element binding protein 2) The peptide sequence was selected from the middle region of CPEB2. Peptide sequence SNTLLPLQVRSSLQLPAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMH.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene CPEB2
Supplier Page Shop

Product images