RPS24 Antibody

Name RPS24 Antibody
Supplier Novus Biologicals
Catalog NBP1-57404
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RPS24(ribosomal protein S24) The peptide sequence was selected from the middle region of RPS24. Peptide sequence GFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RPS24
Conjugate Unconjugated
Supplier Page Shop

Product images