ELAVL4 Antibody

Name ELAVL4 Antibody
Supplier Novus Biologicals
Catalog NBP1-57402
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ELAVL4(ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)) The peptide sequence was selected from the N terminal of ELAVL4. Peptide sequence MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEI
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ELAVL4
Conjugate Unconjugated
Supplier Page Shop

Product images