Name | ELAVL4 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57402 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to ELAVL4(ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)) The peptide sequence was selected from the N terminal of ELAVL4. Peptide sequence MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEI |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | ELAVL4 |
Conjugate | Unconjugated |
Supplier Page | Shop |