RBPMS2 Antibody

Name RBPMS2 Antibody
Supplier Novus Biologicals
Catalog NBP1-57399
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RBPMS2(RNA binding protein with multiple splicing 2) The peptide sequence was selected from the middle region of RBPMS2. Peptide sequence MGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRW.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RBPMS2
Conjugate Unconjugated
Supplier Page Shop

Product images