Nova1 Antibody

Name Nova1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57397
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Guinea Pig, Rabbit, Zebrafish
Antigen Synthetic peptides corresponding to NOVA1(neuro-oncological ventral antigen 1) The peptide sequence was selected from the C terminal of NOVA1. Peptide sequence SKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene NOVA1
Supplier Page Shop

Product images