RNMT Antibody

Name RNMT Antibody
Supplier Novus Biologicals
Catalog NBP1-57390
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RNMT(RNA (guanine-7-) methyltransferase) The peptide sequence was selected from the N terminal of RNMT. Peptide sequence ETEDVPKDKSSTGDGTQNKRKIALEDVPEKQKNLEEGHSSTVAAHYNELQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RNMT
Conjugate Unconjugated
Supplier Page Shop

Product images