DDX1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57379
• Prices: $299.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to DDX1 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 1) The peptide sequence was selected from the C terminal of DDX1. Peptide sequence SQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEK.
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: DDX1
• Conjugate: Unconjugated