U11/U12-35K Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57499
• Prices: $139.00, $299.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to U11/U12-35K The peptide sequence was selected from the N terminal of U11/U12-35K. Peptide sequence RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR.
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: SNRNP35
• Conjugate: Unconjugated