GTP binding protein era homolog Antibody
| Name | GTP binding protein era homolog Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57493 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ERAL1(Era G-protein-like 1 (E. coli)) The peptide sequence was selected from the middle region of ERAL1. Peptide sequence KVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ERAL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GTP binding protein era homolog Antibody [NBP1-57493] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15972_GTP-binding-protein-era-homolog-Antibody-Western-Blot-NBP1-57493-img0003.jpg)
Western Blot: GTP binding protein era homolog Antibody [NBP1-57493] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.