Name | GTP binding protein era homolog Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57493 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to ERAL1(Era G-protein-like 1 (E. coli)) The peptide sequence was selected from the middle region of ERAL1. Peptide sequence KVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKS. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | ERAL1 |
Conjugate | Unconjugated |
Supplier Page | Shop |