FOXRED1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57478
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to FOXRED1(FAD-dependent oxidoreductase domain containing 1) The peptide sequence was selected from the N terminal of FOXRED1. Peptide sequence SEIKKKIKSILPGRSCDLLQDTSHLPPEHSDVVIVGGGVLGLSVAYWLKK.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: FOXRED1
• Conjugate: Unconjugated