GTP binding protein era homolog Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57433
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to ERAL1 (Era G-protein-like 1 (E. coli)) The peptide sequence was selected from the C terminal of ERAL1. Peptide sequence KTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLM.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: ERAL1
• Conjugate: Unconjugated