RBM7 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57429
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to RBM7(RNA binding motif protein 7) The peptide sequence was selected from the middle region of RBM7. Peptide sequence SFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYR.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: RBM7
• Conjugate: Unconjugated