Name | KLHDC8A Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57422 |
Prices | $139.00, $299.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB IHC |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to KLHDC8A (kelch domain containing 8A) The peptide sequence was selected from the C terminal of KLHDC8A. Peptide sequence PGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | KLHDC8A |
Conjugate | Unconjugated |
Supplier Page | Shop |