CPEB2 Antibody
| Name | CPEB2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57416 |
| Prices | $329.00 |
| Sizes | 50 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB Simple Western |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CPEB2 (cytoplasmic polyadenylation element binding protein 2) The peptide sequence was selected from the N terminal of CPEB2. Peptide sequence FLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CPEB2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CPEB2 Antibody [NBP1-57416] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7247_CPEB2-Antibody-Western-Blot-NBP1-57416-img0002.jpg)
Western Blot: CPEB2 Antibody [NBP1-57416] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
![Simple Western: CPEB2 Antibody [NBP1-57416] - Simple Western lane view shows a specific band for CPEB2 in 0.5 mg/ml of Jurkat lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7248_CPEB2-Antibody-Simple-Western-NBP1-57416-img0003.jpg)
Simple Western: CPEB2 Antibody [NBP1-57416] - Simple Western lane view shows a specific band for CPEB2 in 0.5 mg/ml of Jurkat lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.