Name | CPEB2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57416 |
Prices | $329.00 |
Sizes | 50 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB Simple Western |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to CPEB2 (cytoplasmic polyadenylation element binding protein 2) The peptide sequence was selected from the N terminal of CPEB2. Peptide sequence FLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMG. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | CPEB2 |
Conjugate | Unconjugated |
Supplier Page | Shop |