SRP54 Antibody
| Name | SRP54 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57414 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SRP54(signal recognition particle 54kDa) The peptide sequence was selected from the middle region of SRP54. Peptide sequence ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SRP54 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SRP54 Antibody [NBP1-57414] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Placenta](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15688_SRP54%2520Antibody-Western%2520Blot-NBP1-57414-img0003.jpg)
Western Blot: SRP54 Antibody [NBP1-57414] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Placenta