KCTD9 Antibody

Name KCTD9 Antibody
Supplier Novus Biologicals
Catalog NBP1-57662
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KCTD9 (potassium channel tetramerisation domain containing 9) The peptide sequence was selected from the middle region of KCTD9. Peptide sequence AHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFEDPSG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KCTD9
Conjugate Unconjugated
Supplier Page Shop

Product images