TMCO6 Antibody

Name TMCO6 Antibody
Supplier Novus Biologicals
Catalog NBP1-57660
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TMCO6(transmembrane and coiled-coil domains 6) The peptide sequence was selected from the N terminal of TMCO6. Peptide sequence LRQAQRGTEEKEREGALVSLRRGLQHPETQQTFIRLEGSMRTLVGLLTSN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TMCO6
Conjugate Unconjugated
Supplier Page Shop

Product images