ATAT1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57650
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to C6ORF134 The peptide sequence was selected from the middle region of C6ORF134 (NP_079185). Peptide sequence DDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAID.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: ATAT1
• Conjugate: Unconjugated

Product images

Western Blot: ATAT1 Antibody [NBP1-57650] - 293T cells lysate, concentration 0.2-1 ug/ml.