LIN37 Antibody

Name LIN37 Antibody
Supplier Novus Biologicals
Catalog NBP1-57638
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LIN37(lin-37 homolog (C. elegans)) The peptide sequence was selected from the middle region of LIN37. Peptide sequence HQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LIN37
Conjugate Unconjugated
Supplier Page Shop

Product images