Gamma Adaptin Antibody
| Name | Gamma Adaptin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57633 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Rabbit |
| Antigen | Synthetic peptides corresponding to AP1G1(adaptor-related protein complex 1, gamma 1 subunit) The peptide sequence was selected from the C terminal of AP1G1. Peptide sequence DHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTS. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | AP1G1 |
| Supplier Page | Shop |
Product images
![Western Blot: Gamma Adaptin Antibody [NBP1-57633] - Human Brain lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/2516_Gamma-Adaptin-Antibody-Western-Blot-NBP1-57633-img0003.jpg)
Western Blot: Gamma Adaptin Antibody [NBP1-57633] - Human Brain lysate, concentration 0.2-1 ug/ml.