EXOC5 Antibody

Name EXOC5 Antibody
Supplier Novus Biologicals
Catalog NBP1-57629
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to EXOC5 (exocyst complex component 5) The peptide sequence was selected from the N terminal of EXOC5)(50ug). Peptide sequence ATKVCHLGDQLEGVNTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene EXOC5
Conjugate Unconjugated
Supplier Page Shop

Product images