Name | VPS52 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57628 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Rabbit, Zebrafish |
Antigen | Synthetic peptides corresponding to VPS52 (vacuolar protein sorting 52 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of VPS52)(50ug). Peptide sequence RYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEF. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | VPS52 |
Supplier Page | Shop |