VPS52 Antibody

Name VPS52 Antibody
Supplier Novus Biologicals
Catalog NBP1-57628
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Rabbit, Zebrafish
Antigen Synthetic peptides corresponding to VPS52 (vacuolar protein sorting 52 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of VPS52)(50ug). Peptide sequence RYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEF.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene VPS52
Supplier Page Shop

Product images