LMOD1 Antibody

Name LMOD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57623
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LMOD1(leiomodin 1 (smooth muscle)) The peptide sequence was selected from the N terminal of LMOD1. Peptide sequence SRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LMOD1
Conjugate Unconjugated
Supplier Page Shop

Product images