Name | PFKFB4 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57620 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to PFKFB4(6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4) The peptide sequence was selected from the N terminal of PFKFB4. Peptide sequence MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | PFKFB4 |
Conjugate | Unconjugated |
Supplier Page | Shop |