FBXO33 Antibody

Name FBXO33 Antibody
Supplier Novus Biologicals
Catalog NBP1-57619
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FBXO33(F-box protein 33) The peptide sequence was selected from the middle region of FBXO33. Peptide sequence VIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FBXO33
Conjugate Unconjugated
Supplier Page Shop

Product images