FAM80A Antibody

Name FAM80A Antibody
Supplier Novus Biologicals
Catalog NBP1-57618
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FAM80A(family with sequence similarity 80, member A) The peptide sequence was selected from the middle region of FAM80A. Peptide sequence EAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RIMKLA
Conjugate Unconjugated
Supplier Page Shop

Product images