FBXO36 Antibody

Name FBXO36 Antibody
Supplier Novus Biologicals
Catalog NBP1-57616
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FBXO36(F-box protein 36) The peptide sequence was selected from the N terminal of FBXO36. Peptide sequence QVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIFGARILD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FBXO36
Conjugate Unconjugated
Supplier Page Shop

Product images