FBXL16 Antibody

Name FBXL16 Antibody
Supplier Novus Biologicals
Catalog NBP1-57613
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FBXL16(F-box and leucine-rich repeat protein 16) The peptide sequence was selected from the middle region of FBXL16. Peptide sequence GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FBXL16
Conjugate Unconjugated
Supplier Page Shop

Product images