SYDE1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57607
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SYDE1(synapse defective 1, Rho GTPase, homolog 1 (C. elegans)) The peptide sequence was selected from the C terminal of SYDE1. Peptide sequence PYLRPKRQPPLHLPLADPEVVTRPRGRGGPESPPSNRYAGDWSVCGRDFL.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SYDE1
• Conjugate: Unconjugated

Product images

Western Blot: SYDE1 Antibody [NBP1-57607] - Lanes: 1: 2ug mouse SYDE1 transfected HEK293T lysate, 2: 15ug untransfected HEK293T lysate, 3: 100ug wild type mouse brain lysate, 4: 100ug SYDE1 knock-out mouse brain lysate Primary Antibody Dilution: 1:500 Secondary Antibody: Anti-rabbit L-chain HRP Sec

Western Blot: SYDE1 Antibody [NBP1-57607] - Hela, Antibody Dilution: 1.0 ug/ml SYDE1 is supported by BioGPS gene expression data to be expressed in HeLa.

Western Blot: SYDE1 Antibody [NBP1-57607] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.