MRPL13 Antibody

Name MRPL13 Antibody
Supplier Novus Biologicals
Catalog NBP1-57600
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Dog, Guinea Pig, Rabbit, Zebrafish
Antigen Synthetic peptides corresponding to MRPL13(mitochondrial ribosomal protein L13) The peptide sequence was selected from the middle region of MRPL13. Peptide sequence AIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLD.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene MRPL13
Supplier Page Shop

Product images