ASB7 Antibody

Name ASB7 Antibody
Supplier Novus Biologicals
Catalog NBP1-57599
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ASB7 (ankyrin repeat and SOCS box-containing 7) The peptide sequence was selected from the middle region of ASB7)(50ug). Peptide sequence QTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ASB7
Conjugate Unconjugated
Supplier Page Shop

Product images