Name | SAMD4A Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57597 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to the middle region of SAMD4A(sterile alpha motif domain containing 4A). Peptide sequence LKSLRLHKYAALFSQMTYEEMMALTECQLEAQNVTKGARHKIVISIQKLK. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | SAMD4A |
Conjugate | Unconjugated |
Supplier Page | Shop |