SAMD4A Antibody

Name SAMD4A Antibody
Supplier Novus Biologicals
Catalog NBP1-57597
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to the middle region of SAMD4A(sterile alpha motif domain containing 4A). Peptide sequence LKSLRLHKYAALFSQMTYEEMMALTECQLEAQNVTKGARHKIVISIQKLK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SAMD4A
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.