C11orf53 Antibody

Name C11orf53 Antibody
Supplier Novus Biologicals
Catalog NBP1-57594
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C11ORF53 The peptide sequence was selected from the middle region of C11ORF53. Peptide sequence SIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C11orf53
Conjugate Unconjugated
Supplier Page Shop

Product images