Name | IDI1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57587 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Bovine, Horse, Guinea Pig |
Antigen | Synthetic peptides corresponding to IDI1(isopentenyl-diphosphate delta isomerase 1) The peptide sequence was selected from the middle region of IDI1. Peptide sequence PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKA. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | IDI1 |
Supplier Page | Shop |