IDI1 Antibody

Name IDI1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57587
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Horse, Guinea Pig
Antigen Synthetic peptides corresponding to IDI1(isopentenyl-diphosphate delta isomerase 1) The peptide sequence was selected from the middle region of IDI1. Peptide sequence PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKA.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene IDI1
Supplier Page Shop

Product images