CKI gamma 3 Antibody

Name CKI gamma 3 Antibody
Supplier Novus Biologicals
Catalog NBP1-57573
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CSNK1G3(casein kinase 1, gamma 3) The peptide sequence was selected from the middle region of CSNK1G3. Peptide sequence LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CSNK1G3
Conjugate Unconjugated
Supplier Page Shop

Product images