Name | CKI gamma 3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57573 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to CSNK1G3(casein kinase 1, gamma 3) The peptide sequence was selected from the middle region of CSNK1G3. Peptide sequence LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | CSNK1G3 |
Conjugate | Unconjugated |
Supplier Page | Shop |