PAPOLB Antibody

Name PAPOLB Antibody
Supplier Novus Biologicals
Catalog NBP1-57561
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Dog, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to PAPOLB(poly(A) polymerase beta (testis specific)) The peptide sequence was selected from the middle region of PAPOLB. Peptide sequence MEEFRTMWVIGLGLKKPDNSEILSIDLTYDIQSFTDTVYRQAVNSKMFEM.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene PAPOLB
Supplier Page Shop

Product images