PAPOLB Antibody

Name PAPOLB Antibody
Supplier Novus Biologicals
Catalog NBP1-57560
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Dog, Rabbit, Zebrafish
Antigen Synthetic peptides corresponding to PAPOLB(poly(A) polymerase beta (testis specific)) The peptide sequence was selected from the N terminal of PAPOLB. Peptide sequence TDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESK.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene PAPOLB
Supplier Page Shop

Product images