Name | PAPOLB Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57560 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Dog, Rabbit, Zebrafish |
Antigen | Synthetic peptides corresponding to PAPOLB(poly(A) polymerase beta (testis specific)) The peptide sequence was selected from the N terminal of PAPOLB. Peptide sequence TDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESK. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | PAPOLB |
Supplier Page | Shop |