RBM47 Antibody
| Name | RBM47 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57559 |
| Prices | $329.00 |
| Sizes | 50 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RBM47(RNA binding motif protein 47) The peptide sequence was selected from the middle region of RBM47. Peptide sequence HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RBM47 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RBM47 Antibody [NBP1-57559] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1919_RBM47-Antibody-Western-Blot-NBP1-57559-img0007.jpg)
Western Blot: RBM47 Antibody [NBP1-57559] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
![Immunohistochemistry: RBM47 Antibody [NBP1-57559] - Staining of human Colon.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1920_RBM47-Antibody-Immunohistochemistry-NBP1-57559-img0003.jpg)
Immunohistochemistry: RBM47 Antibody [NBP1-57559] - Staining of human Colon.
![Western Blot: RBM47 Antibody [NBP1-57559] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1921_RBM47-Antibody-Western-Blot-NBP1-57559-img0002.jpg)
Western Blot: RBM47 Antibody [NBP1-57559] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: RBM47 Antibody [NBP1-57559] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1922_RBM47-Antibody-Western-Blot-NBP1-57559-img0004.jpg)
Western Blot: RBM47 Antibody [NBP1-57559] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
![Western Blot: RBM47 Antibody [NBP1-57559] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1923_RBM47-Antibody-Western-Blot-NBP1-57559-img0005.jpg)
Western Blot: RBM47 Antibody [NBP1-57559] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
![Western Blot: RBM47 Antibody [NBP1-57559] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1924_RBM47-Antibody-Western-Blot-NBP1-57559-img0006.jpg)
Western Blot: RBM47 Antibody [NBP1-57559] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
![Western Blot: RBM47 Antibody [NBP1-57559] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/1925_RBM47%2520Antibody-Western%2520Blot-NBP1-57559-img0008.jpg)
Western Blot: RBM47 Antibody [NBP1-57559] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.