RED2 Antibody

Name RED2 Antibody
Supplier Novus Biologicals
Catalog NBP1-57558
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ADARB2(adenosine deaminase, RNA-specific, B2 (RED2 homolog rat)) The peptide sequence was selected from the middle region of ADARB2 (NP_061172). Peptide sequence: SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ADARB2
Conjugate Unconjugated
Supplier Page Shop

Product images