Name | RED2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57558 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to ADARB2(adenosine deaminase, RNA-specific, B2 (RED2 homolog rat)) The peptide sequence was selected from the middle region of ADARB2 (NP_061172). Peptide sequence: SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | ADARB2 |
Conjugate | Unconjugated |
Supplier Page | Shop |