LARP7 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57554
• Prices: $139.00, $299.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to LARP7 (La ribonucleoprotein domain family, member 7) The peptide sequence was selected from the C terminal of LARP7. Peptide sequence HCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITKAEKIRL.
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: LARP7
• Conjugate: Unconjugated