GLXR5 Antibody

Name GLXR5 Antibody
Supplier Novus Biologicals
Catalog NBP1-57645
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GLRX5(glutaredoxin 5) The peptide sequence was selected from the middle region of GLRX5 (NP_057501). Peptide sequence NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GLRX5
Conjugate Unconjugated
Supplier Page Shop

Product images