Name | TPPP3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57640 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Horse, Zebrafish |
Antigen | Synthetic peptides corresponding to TPPP3(tubulin polymerization-promoting protein family member 3) The peptide sequence was selected from the middle region of TPPP3. Peptide sequence PANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDD. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | TPPP3 |
Supplier Page | Shop |