TPPP3 Antibody

Name TPPP3 Antibody
Supplier Novus Biologicals
Catalog NBP1-57640
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Horse, Zebrafish
Antigen Synthetic peptides corresponding to TPPP3(tubulin polymerization-promoting protein family member 3) The peptide sequence was selected from the middle region of TPPP3. Peptide sequence PANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDD.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene TPPP3
Supplier Page Shop

Product images