GTPBP2 Antibody

Name GTPBP2 Antibody
Supplier Novus Biologicals
Catalog NBP1-57648
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Goat, Zebrafish
Antigen Synthetic peptides corresponding to GTPBP2(GTP binding protein 2) The peptide sequence was selected from the N terminal of GTPBP2. Peptide sequence GCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEYKLKLVNPSQYRFEH.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene GTPBP2
Supplier Page Shop

Product images