PDIK1L Antibody

Name PDIK1L Antibody
Supplier Novus Biologicals
Catalog NBP1-56733
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PDIK1L(PDLIM1 interacting kinase 1 like) The peptide sequence was selected from the middle region of PDIK1L. Peptide sequence TSDLEPTLKVADFGLSKVCSASGQNPEEPVSVNKCFLSTACGTDFYMAPE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PDIK1L
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.