RWDD4A Antibody

Name RWDD4A Antibody
Supplier Novus Biologicals
Catalog NBP1-56731
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RWDD4A(RWD domain containing 4A) The peptide sequence was selected from the N terminal of RWDD4A. Peptide sequence MSANEDQEMELEALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEIS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RWDD4
Conjugate Unconjugated
Supplier Page Shop

Product images