ARL13B Antibody
| Name | ARL13B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56715 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ARL13B(ADP-ribosylation factor-like 13B) The peptide sequence was selected from the middle region of ARL13B. Peptide sequence VEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ARL13B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ARL13B Antibody [NBP1-56715] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24231_ARL13B-Antibody-Western-Blot-NBP1-56715-img0003.jpg)
![Western Blot: ARL13B Antibody [NBP1-56715] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: 721_B cell lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24232_ARL13B%2520Antibody-Western%2520Blot-NBP1-56715-img0004.jpg)