GPRASP2 Antibody

Name GPRASP2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56710
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GPRASP2(G protein-coupled receptor associated sorting protein 2) The peptide sequence was selected from the middle region of GPRASP2. Peptide sequence EQESLLQPDQPSPEFTFQYDPSYRSVREIREHLRARESAESESWSCSCIQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GPRASP2
Conjugate Unconjugated
Supplier Page Shop

Product images