PRELID2 Antibody

Name PRELID2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56751
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PRELID2(PRELI domain containing 2) The peptide sequence was selected from the C terminal of PRELID2. Peptide sequence GRISITGVGFLNCVLETFASTFLRQGAQKGIRIMEMLLKEQCGAPLAE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PRELID2
Conjugate Unconjugated
Supplier Page Shop

Product images